PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012296-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 213aa    MW: 25227.5 Da    PI: 5.7138
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012296-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.77.6e-4351343128
                    NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            +GfrF Pt+eel+++yL kk++g + ++++vi+ ++iy++ Pw+Lp+     +++++++w+fF+  ++++a+g r+nr t++gyWkat
  SMil_00012296-RA_Salv   5 VGFRFYPTEEELLCYYLPKKLNGPTPHIDRVIPLLRIYDYSPWELPQfageVCRGDREQWFFFTAMQEREARGGRTNRLTQNGYWKAT 92 
                            7***************************999***************656754455777****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            g+  +v+++++  +g kkt+vfy+grap+g+kt+W m+ey+l
  SMil_00012296-RA_Salv  93 GSPCDVFDRRNLRIGRKKTMVFYEGRAPHGSKTTWKMNEYKL 134
                            ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.2073155IPR003441NAC domain
SuperFamilySSF1019413.14E-464155IPR003441NAC domain
PfamPF023651.1E-215134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MEEHVGFRFY PTEEELLCYY LPKKLNGPTP HIDRVIPLLR IYDYSPWELP QFAGEVCRGD  60
REQWFFFTAM QEREARGGRT NRLTQNGYWK ATGSPCDVFD RRNLRIGRKK TMVFYEGRAP  120
HGSKTTWKMN EYKLYHQSSI SQLREELSLC RIYKKSEIVR AFDRRPPAEE AAVTAIPNPT  180
AVENHEFDWD MATDEIESLE DSDIQMLLNW FDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-30615520165NO APICAL MERISTEM PROTEIN
1ut4_B4e-30615520165NO APICAL MERISTEM PROTEIN
1ut7_A4e-30615520165NO APICAL MERISTEM PROTEIN
1ut7_B4e-30615520165NO APICAL MERISTEM PROTEIN
3swm_A5e-30615523168NAC domain-containing protein 19
3swm_B5e-30615523168NAC domain-containing protein 19
3swm_C5e-30615523168NAC domain-containing protein 19
3swm_D5e-30615523168NAC domain-containing protein 19
3swp_A5e-30615523168NAC domain-containing protein 19
3swp_B5e-30615523168NAC domain-containing protein 19
3swp_C5e-30615523168NAC domain-containing protein 19
3swp_D5e-30615523168NAC domain-containing protein 19
4dul_A4e-30615520165NAC domain-containing protein 19
4dul_B4e-30615520165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077925.11e-73PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR35e-63NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UQS74e-71A0A068UQS7_COFCA; Uncharacterized protein
STRINGSolyc11g068620.1.11e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.22e-66NAC domain containing protein 61